PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.007G067000.2
Common NamePHAVU_007G067000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family FAR1
Protein Properties Length: 885aa    MW: 101280 Da    PI: 6.3635
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.007G067000.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR182.19.6e-2675161188
                FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                         +fYn+YA+ vGF+vrk+  ++sk +g++++r+f+Cskeg+r+++k++ ++ +++r+etrtgC a++ v+++ +g+++vt++e +HnH+
  Phvul.007G067000.2  75 RFYNKYARLVGFNVRKDWINRSKVHGQVVSRKFTCSKEGYRRKDKRD-VNVKKHRKETRTGCLAHMIVTRQPNGRYQVTHFEAQHNHD 161
                         5*******************************************999.999************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.8E-2375161IPR004330FAR1 DNA binding domain
PfamPF105511.4E-22285379IPR018289MULE transposase domain
PROSITE profilePS5096610.151565601IPR007527Zinc finger, SWIM-type
SMARTSM005750.0012576603IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 885 aa     Download sequence    Send to blast
MDGDRKELGI VHEGSFDVEP QILNNLDLNV EQNCCSPNMA HASDNQSCPP SKNVLSANSV  60
LGIGTEFESD DHAYRFYNKY ARLVGFNVRK DWINRSKVHG QVVSRKFTCS KEGYRRKDKR  120
DVNVKKHRKE TRTGCLAHMI VTRQPNGRYQ VTHFEAQHNH DHVNPNNANV LNLLNEFSVA  180
QAVEAESNNS LGPKSKSALD TLNKKISAHE SIDLLSMNYD NYLHCARERD MKEGEAGRLF  240
GYFQRQHFEN PTFFYAIQLD VDDKVSNIFW AEDNMVVDYD HFGDVICLDT ICRTNEDLRP  300
FVQFLGVNHH KQVLVFAAAF LYDDSIESFN WLFRTFINAM SGKKPKAILT EQEAVIIEAV  360
NTVLPDTNHC TCVWQLYENT LKHLSHVVKD AESFANVLRS SIYDPKDEEE FTHSWETMLE  420
RYNLQQNEWL RWMYREREKW AVVFGQNTFF VDIKGFHLAE ILSHKFRSYL NPDTDVVQFF  480
KHFERVVGEQ RHKEIEAGDE MSRCLPRLMG NMVLLKHASN IYTPRAFEVF QQAYEKSLNV  540
IVNQHSRNGS LFEYKANTFG HNRQYSVTFN SSDDTVVCSC MKFDRVGFLC GHALKVLDQR  600
NIKVVPSQYI LERWTGDARM GNLREIKQCK MQDNPKRVPA SCYKDLCHRL LKCSARASES  660
EEAYQFAMRQ LDEMMVGVEK ILTLKAEGQV ITSRNIDADA SESEPSKIFL NGHVIDAQDE  720
SNSANGGKDR RATSDRGHLT TMTCNGTDSD RILNVEESPQ NTVVCISSAP STYVSSQPAA  780
PNLILQGLYS FEANQVVHCM YEQTNLVLDN QSNSSMLQPQ NIFSNPQDSP GQSQLLQEPI  840
IQSAYLESLP SNNQMRQGMD LDIQNPHSSS FLLYDHRYRS SESA*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007143371.10.0hypothetical protein PHAVU_007G067000g
RefseqXP_007143372.10.0hypothetical protein PHAVU_007G067000g
TrEMBLV7BFU70.0V7BFU7_PHAVU; Uncharacterized protein
STRINGGLYMA10G38320.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-97FAR1-related sequence 5